Endoglin/CD105 Recombinant monoclonal antibody

• 

  WB analysis of bEnd.3 using 84807-5-RR

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 84807-5-RR (Endoglin/CD105 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 84807-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84807-5-RR (Endoglin/CD105 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 84807-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84807-5-RR (Endoglin/CD105 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84807-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84807-5-RR against Mouse Endoglin/CD105 were performed. The affinity constant is 0.766 nM.

Endoglin/CD105 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84807-5-RR

Clone No.242305A11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

CD105, 242305A11, Edg, endoglin, Eng

---

Tested Applications

• Positive WB detected in: bEnd.3 cells
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84807-5-RR targets Endoglin/CD105 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1292

  Product name: Recombinant Mouse Endoglin/CD105 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 27-580 aa of NM_007932.2

  Sequence: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGK

• Full Name: endoglin
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: NM_007932.2
• Gene Symbol: CD105
• Gene ID (NCBI): 13805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q63961
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Endoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 90-95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481)