Endothelin 3 Polyclonal antibody

• 

  WB analysis using 27871-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27871-1-AP (Endothelin 3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 27871-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27871-1-AP (EDN3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 27871-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27871-1-AP (EDN3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 27871-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 27871-1-AP (EDN3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 27871-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 27871-1-AP (EDN3 antibody) at dilution of 1:200 (under 0x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 27871-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using Endothelin 3 antibody (27871-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

Endothelin 3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27871-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EDN3, Endothelin-3, ET 3, ET3, ET-3

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, rat pancreas tissue
• Positive IHC detected in: human thyroid cancer tissue, human oesophagus cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27871-1-AP targets Endothelin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27393

  Product name: Recombinant human EDN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-198 aa of BC053866

  Sequence: SQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVE

• Full Name: endothelin 3
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC053866
• Gene Symbol: Endothelin 3
• Gene ID (NCBI): 1908
• RRID: AB_3086000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14138
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Endothelin 3 (EDN3) is also named as ET-3 and Preproendothelin-3 (PPET3). Endothelin 3 belongs to the endothelin/sarafotoxin family. It reported downregulation of EDN3 as a result of methylation of its promoter in breast cancer, and EDN3 level was also decreased in cervical cancer (PMID: 36542159). ET-3 is the most abundant ET peptide in the rat brain, mainly localized to neurons and glia of the neostriatum, hypothalamic nuclei, hippocampus, and Purkinje cells of the cerebellum and medulla oblongata (PMID: 32589590).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochem Biophys Res Commun; Palmitoyl copper peptide and acetyl tyrosine complex enhances melanin production in both A375 and B16 cell lines; Authors - Minhua Hong