EpCAM/TROP1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP01009-4

  The mean EPCAM/CD326 concentration was determined to be 492922.2 pg/mL in HT-116 cell extract based on a 2.0 mg/mL extract load.

• 

  Sandwich ELISA sample test of MP01009-4

  HT-29 were cultured in DMEM supplemented with 10% fetal bovine serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. An aliquot of the cell culture supernate was removed, assayed for human EPCAM/CD326, and measured 6718.5 pg/mL.

• 

  Sandwich ELISA sample test of MP01009-4

  Serum of six individual healthy human donors was measured. The EPCAM/CD326 concentration of detected samples was determined to be 484.9 pg/mL with a range of 81.5-2002.2 pg/mL.

• 

  Sandwich ELISA standard curve of MP01009-4

  Sandwich ELISA standard curve of MP01009-4, Human EPCAM/CD326 Recombinant Matched Antibody Pair - PBS only. 84073-7-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1370. 84073-4-PBS was HRP conjugated as the detection antibody. Range: 19.5-625 pg/mL.

• 

  Affinity and Kinetic Characterization of 84073-7-PBS

  Biolayer interferometry (BLl) kinetic assay of 84073-7-PBS against Human EpCAM/TROP1 was performed. The affinity constant is 2.13 nM.

EpCAM/TROP1 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 84073-7-PBS

Clone No.241243F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

84073-7-PBS targets EpCAM/TROP1 as part of a matched antibody pair:

MP01009-4: 84073-7-PBS capture and 84073-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1370

  Product name: Recombinant Human EpCAM/CD326 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-265 aa of NM_002354.3

  Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

• Full Name: epithelial cell adhesion molecule
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_002354.3
• Gene Symbol: EPCAM
• Gene ID (NCBI): 4072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16422
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.