Ephrin A3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Ephrin A3 Polyclonal antibody, PBS Only (12480-1-PBS)

• 

  WB analysis of human brain using 12480-1-AP (same clone as 12480-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12480-1-AP (Ephrin A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12480-1-AP (same clone as 12480-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12480-1-AP (Ephrin A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12480-1-AP (same clone as 12480-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12480-1-AP (Ephrin A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A549 using 12480-1-AP (same clone as 12480-1-PBS)

  IP result of anti-Ephrin A3 (IP:12480-1-AP, 4ug; Detection:12480-1-AP 1:500) with A549 cells lysate 1040ug. This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 12480-1-AP (same clone as 12480-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 12480-1-AP (Ephrin A3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 12480-1-AP (same clone as 12480-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 12480-1-AP (Ephrin A3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 12480-1-AP (same clone as 12480-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Ephrin A3 antibody (12480-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 12480-1-AP (same clone as 12480-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Ephrin A3 antibody (12480-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12480-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Ephrin A3 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 12480-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

EFL2, EFNA3, EPLG3, LERK3, EFL 2

---

Product Information

12480-1-PBS targets Ephrin A3 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3188

  Product name: Recombinant human EFNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-222 aa of BC017722

  Sequence: LGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHL

• Full Name: ephrin-A3
• Calculated Molecular Weight: 238 aa, 26 kDa
• Observed Molecular Weight: 26-35 kDa
• GenBank Accession Number: BC017722
• Gene Symbol: Ephrin A3
• Gene ID (NCBI): 1944
• RRID: AB_10638305
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52797
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.