Ezrin Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP02097-2

  Sandwich ELISA standard curve of MP02097-2, Human Ezrin Recombinant Matched Antibody Pair - PBS only. 85790-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag23530. 85790-2-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

• 

  Sample test of MP02097-2

  Serum of six individual healthy human donors was measured. The Ezrin concentration of detected samples was determined to be 2.18 ng/mL with a range of 1.13-3.73 ng/mL.

• 

  Sample test of MP02097-2

  The mean Ezrin concentration was determined to be 27.86 ng/mL in HeLa cell extract based on a 1.50 mg/mL extract load and 13.61 ng/mL in NIH/3T3 cell extract based on a 1.50 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02097-2

  Cytometric bead array standard curve of MP02097-2, Ezrin Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85790-3-PBS. Detection antibody: 85790-2-PBS. Standard: Ag23530. Range: 0.781-100 ng/mL.

Ezrin Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85790-2-PBS

Clone No.250065B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

EZR, VIL2, Villin-2

---

Product Information

85790-2-PBS targets Ezrin as part of a matched antibody pair:

MP02097-2: 85790-3-PBS capture and 85790-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23530

  Product name: Recombinant human Ezrin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 477-529 aa of BC013903

  Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR

• Full Name: ezrin
• Calculated Molecular Weight: 69 kDa
• GenBank Accession Number: BC013903
• Gene Symbol: Ezrin
• Gene ID (NCBI): 7430
• ENSEMBL Gene ID: ENSG00000092820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15311
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.