Ezrin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85790-4-RR (same clone as 85790-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85790-4-RR (Ezrin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85790-4-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 85790-4-RR (same clone as 85790-4-PBS)

  WB result of Ezrin antibody (85790-4-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Ezrin transfected HeLa cells. This data was developed using the same antibody clone with 85790-4-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 85790-4-RR (same clone as 85790-4-PBS)

  IP result of anti-Ezrin (IP:85790-4-RR, 4ug; Detection:85790-4-RR 1:3000) with HeLa cells lysate 1280 ug. This data was developed using the same antibody clone with 85790-4-PBS in a different storage buffer formulation.

• 

  IHC staining of Mouse small intestine using 85790-4-RR (same clone as 85790-4-PBS)

  Immunohistochemical analysis of paraffin-embedded Mouse small intestine tissue slide using 85790-4-RR (Ezrin antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH6). This data was developed using the same antibody clone with 85790-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 85790-4-RR (same clone as 85790-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 85790-4-RR (Ezrin antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 85790-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85790-4-RR (same clone as 85790-4-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Ezrin antibody (85790-4-RR, Clone: 250065E1 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85790-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85790-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85790-4-RR against Human Ezrin were performed. The affinity constant is 0.426 nM.

• Featured Product
• KD/KO Validated

Ezrin Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 85790-4-PBS

Clone No.250065E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

EZR, VIL2, Villin-2

---

Product Information

85790-4-PBS targets Ezrin in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23530

  Product name: Recombinant human Ezrin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 477-529 aa of BC013903

  Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR

• Full Name: ezrin
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC013903
• Gene Symbol: Ezrin
• Gene ID (NCBI): 7430
• ENSEMBL Gene ID: ENSG00000092820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15311
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ezrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis.