FXI Polyclonal antibody

• 

  WB analysis using 24321-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24321-1-AP (FXI antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

FXI Polyclonal Antibody for WB, ELISA

Cat No. 24321-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

F11, Coagulation factor XIa heavy chain, Coagulation factor XIa light chain, EC:3.4.21.27, PTA

---

Tested Applications

• Positive WB detected in: rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24321-1-AP targets FXI in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18004

  Product name: Recombinant human F11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 58-397 aa of BC119014

  Sequence: LFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRG

• Full Name: coagulation factor XI
• Calculated Molecular Weight: 625 aa, 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC119014
• Gene Symbol: F11
• Gene ID (NCBI): 2160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P03951
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Factor XI (FXI) is the zymogen of a blood coagulation protease, factor XIa (FXIa), that contributes to hemostasis by activating factor IX. Factor XI is a precursor of an S1 serine protease found in blood plasma. When activated to FXIa, it plays a crucial role in forming and stabilizing fibrin by triggering the activation of factor IX (PMID: 38545505). FXI has 2 isoforms with the molecular mass of 70 kDa and 64 kDa. Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.