Product Information
86509-1-PBS targets F2RL3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag13624 Product name: Recombinant human F2RL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 305-385 aa of BC074782 Sequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ Predict reactive species |
| Full Name | coagulation factor II (thrombin) receptor-like 3 |
| Calculated Molecular Weight | 385 aa, 41 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC074782 |
| Gene Symbol | F2RL3 |
| Gene ID (NCBI) | 9002 |
| RRID | AB_3744934 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96RI0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Coagulation factor II receptor-like 3 (F2RL3) encodes a member of the protease-activated receptor subfamily, also known as protease-activated receptor 4 (PAR4), which takes partin platelet activation, intimal hyperplasia and inflammation (PMID:34284820). An absence of PAR4 in mouse models results in impaired hemostasis and a protection against pulmonary embolism, and a small number of missense coding variants in F2RL3 that alter platelet aggregation and function have been described(PMID:35012325).



