F2RL3 Recombinant monoclonal antibody

• 

  WB analysis using 86509-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86509-1-RR (F2RL3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86509-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86509-1-RR against Human F2RL3 were performed. The affinity constant is 22.3 nM.

F2RL3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86509-1-RR

Clone No.250132A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Coagulation factor II receptor-like 3, PAR 4, PAR4, PAR-4, Proteinase activated receptor 4

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, rat pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86509-1-RR targets F2RL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13624

  Product name: Recombinant human F2RL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 305-385 aa of BC074782

  Sequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ

• Full Name: coagulation factor II (thrombin) receptor-like 3
• Calculated Molecular Weight: 385 aa, 41 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC074782
• Gene Symbol: F2RL3
• Gene ID (NCBI): 9002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RI0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Coagulation factor II receptor-like 3 (F2RL3) encodes a member of the protease-activated receptor subfamily, also known as protease-activated receptor 4 (PAR4), which takes partin platelet activation, intimal hyperplasia and inflammation (PMID:34284820). An absence of PAR4 in mouse models results in impaired hemostasis and a protection against pulmonary embolism, and a small number of missense coding variants in F2RL3 that alter platelet aggregation and function have been described(PMID:35012325).