Tissue Factor/CD142 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Tissue Factor/CD142 Monoclonal antibody (67056-1-Ig)

Tissue Factor/CD142 Monoclonal Antibody for WB, ELISA

Cat No. 67056-1-Ig Copied!

Clone No. 2E4A1

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, 2E4A1

• 

  WB analysis of A431 using 67056-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 67056-1-Ig (Tissue Factor antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67056-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67056-1-Ig (Tissue Factor/CD142 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67056-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67056-1-Ig (Tissue Factor/CD142 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of hTERT-RPE1 using 67056-1-Ig

  hTERT-RPE1 cells were subjected to SDS PAGE followed by western blot with 67056-1-Ig (Tissue Factor/CD142 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human blood using 67056-1-Ig

  human blood were subjected to SDS PAGE followed by western blot with 67056-1-Ig (Tissue Factor antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Tissue Factor/CD142 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Calu-1 cells, A431 cells, hTERT-RPE1 cells, human blood, MDA-MB-231 cells, OS-RC-2 cells, PNGF treated MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67056-1-Ig targets Tissue Factor/CD142 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27563

  Product name: Recombinant human F3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 113-251 aa of BC011029

  Sequence: GNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Full Name: coagulation factor III (thromboplastin, tissue factor)
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 37 kDa, 45-50 kDa
• GenBank Accession Number: BC011029
• Gene Symbol: F3
• Gene ID (NCBI): 2152
• RRID: AB_2882367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13726
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III, F3 or CD142, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).

Publications

What published studies show

The Tissue Factor/CD142 Monoclonal antibody (2E4A1), catalog number 67056-1-Ig, has 2 total citations. These citations appear in Acta Pharmacologica Sinica and Heliyon. The associated research fields include cardiovascular pharmacology (atherosclerotic plaque stability and inflammation) and stem cell biology (mesenchymal stem cell function enhancement via hypoxic production systems). Both studies utilized the antibody for Western blot analysis in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Acta Pharmacol Sin; Urolithin A promotes atherosclerotic plaque stability by limiting inflammation and hypercholesteremia in Apolipoprotein E-deficient mice; Authors - Meng-Yun Xu
human	WB	Heliyon; Enhancement of the function of mesenchymal stem cells by using a GMP-grade three-dimensional hypoxic large-scale production system; Authors - Yiyao Qi