Tissue Factor/CD142 Monoclonal antibody, PBS Only

• 

  WB analysis of A431 using 67056-1-Ig (same clone as 67056-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 67056-1-Ig (Tissue Factor antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67056-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human blood using 67056-1-Ig (same clone as 67056-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 67056-1-Ig (Tissue Factor antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67056-1-PBS in a different storage buffer formulation.

Tissue Factor/CD142 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67056-1-PBS

Clone No.2E4A1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, 2E4A1

---

Product Information

67056-1-PBS targets Tissue Factor/CD142 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27563

  Product name: Recombinant human F3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 113-251 aa of BC011029

  Sequence: GNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Full Name: coagulation factor III (thromboplastin, tissue factor)
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC011029
• Gene Symbol: F3
• Gene ID (NCBI): 2152
• RRID: AB_2882367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13726
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.