FABP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FABP1 Polyclonal antibody, PBS Only (13626-1-PBS)

• 

  WB analysis using 13626-1-AP (same clone as 13626-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13626-1-AP (FABP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13626-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13626-1-AP (same clone as 13626-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13626-1-AP (FABP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13626-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 13626-1-AP (same clone as 13626-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13626-1-AP (FABP1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13626-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 13626-1-AP (same clone as 13626-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13626-1-AP (FABP1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13626-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FABP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13626-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

liver FABP, FABPL, Fatty acid binding protein 1, Fatty acid-binding protein 1, Fatty acid-binding protein, liver

---

Product Information

13626-1-PBS targets FABP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4540

  Product name: Recombinant human FABP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-127 aa of BC032801

  Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

• Full Name: fatty acid binding protein 1, liver
• Calculated Molecular Weight: 127 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC032801
• Gene Symbol: FABP1
• Gene ID (NCBI): 2168
• RRID: AB_2102017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07148
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).