CoraLite® Plus 488-conjugated FABP3 Polyclonal antibody

• 

  IF Staining of mouse brain using CL488-10676

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 FABP3 antibody (CL488-10676) at dilution of 1:200.

• 

  IF Staining of mouse brain using CL488-10676

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 FABP3 antibody (CL488-10676) at dilution of 1:200.

• Featured Product
• KD/KO Validated

FABP3 Polyclonal Antibody for IF-P

Cat No. CL488-10676

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

FABP11, FABP3, Fatty acid binding protein 3, H FABP, M FABP, MDGI, O FABP

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10676 targets FABP3 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1069

  Product name: Recombinant human FABP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-133 aa of BC007021

  Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

• Full Name: fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC007021
• Gene Symbol: FABP3
• Gene ID (NCBI): 2170
• RRID: AB_3672459
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05413
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle.