Use Able AI chat for product recommendations

FABP9 Polyclonal antibody, PBS Only

FABP9 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31896-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Fatty Acid Binding Protein 9, Fatty acid-binding protein 9, Testis lipid-binding protein, Testis-type fatty acid-binding protein, T-FABP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

31896-1-PBS targets FABP9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag35224

Product name: Recombinant human FABP9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 18-100 aa of NM_001080526

Sequence: EDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLG

Predict reactive species
Full Name fatty acid binding protein 9, testis
Calculated Molecular Weight15 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberNM_001080526
Gene Symbol FABP9
Gene ID (NCBI) 646480
RRIDAB_3742489
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ0Z7S8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FABP9 (Fatty Acid-Binding Protein 9) is a cytoplasmic protein and a member of the fatty acid-binding protein superfamily. It is specifically and highly expressed in testicular tissue and plays a critical role in the differentiation of male germ cells. This protein reversibly binds hydrophobic ligands such as fatty acids and retinol, mediating intracellular lipid transport and metabolic regulation. During spermatogenesis, FABP9 maintains the attachment of the acrosome to the sperm nucleus, which is essential for fertilization. Recent studies have revealed that FABP9 is significantly overexpressed in various tumors, including prostate cancer and breast cancer, where it promotes tumor progression through lipid metabolism reprogramming and regulation of the G2/M checkpoint. Its expression is associated with poor patient prognosis, making it a potential diagnostic biomarker and therapeutic target.

Loading...
||
New chat

Able

正在加载,请稍候...