CoraLite® Plus 488-conjugated FADS2 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-84527-5

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 FADS2 antibody (CL488-84527-5, Clone: 241863G3 ) at dilution of 1:200.

FADS2 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84527-5

Clone No.241863G3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241863G3, Acyl-CoA 6-desaturase, D6D, Delta-6 desaturase, EC:1.14.19.3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84527-5 targets FADS2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27715

  Product name: Recombinant human FADS2-Specific protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-124 aa of BC009011

  Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN

• Full Name: fatty acid desaturase 2
• Calculated Molecular Weight: 445 aa, 49 kDa
• GenBank Accession Number: BC009011
• Gene Symbol: FADS2
• Gene ID (NCBI): 9415
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95864
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms and can be detected as 46-52 kDa.