Home
Products
Primary Antibodies
FAM103A1 Polyclonal antibody, PBS Only (19422-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis of A549 using 19422-1-AP (same clone as 19422-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 19422-1-AP (FAM103A1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 19422-1-AP (same clone as 19422-1-PBS)
MCF-7 cells were subjected to SDS PAGE followed by western blot with 19422-1-AP (FAM103A1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.
WB analysis of PC-3 using 19422-1-AP (same clone as 19422-1-PBS)
PC-3 cells were subjected to SDS PAGE followed by western blot with 19422-1-AP (FAM103A1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 19422-1-AP (same clone as 19422-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 19422-1-AP (FAM103A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 19422-1-AP (same clone as 19422-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 19422-1-AP (FAM103A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 19422-1-AP (same clone as 19422-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 19422-1-AP (FAM103A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 19422-1-AP (same clone as 19422-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 19422-1-AP (FAM103A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.
IF Staining of MCF-7 using 19422-1-AP (same clone as 19422-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using 19422-1-AP (FAM103A1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 19422-1-PBS in a different storage buffer formulation.

FAM103A1 Polyclonal antibody, PBS Only

Name: FAM103A1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 19422-1-PBS

FAM103A1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 19422-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

19422-1-PBS targets FAM103A1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13749 Product name: Recombinant human FAM103A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC003627 Sequence: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY Predict reactive species
Full Name	family with sequence similarity 103, member A1
Calculated Molecular Weight	118 aa, 14 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC003627
Gene Symbol	FAM103A1
Gene ID (NCBI)	83640
RRID	AB_2878578
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BTL3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

FAM103A1, also named as RNMT-activating mini protein, is a 118 amino acid protein, which belongs to the RAM family. FAM103A1 as a component of mRNA cap binding complex localizes in the nucleus. FAM103A1 is required for efficient mRNA cap methylation and regulates RNMT expression by a post-transcriptional stabilizing mechanism.