Use Able AI chat for product recommendations

OTULIN Polyclonal antibody

OTULIN Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

FAM105B, Deubiquitinating enzyme otulin, EC:3.4.19.12, OTU domain-containing deubiquitinase with linear linkage specificity, Protein FAM105B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for OTULIN in ?

Tested Applications

Positive WB detected inHEK-293T cells, mouse brain tissue, HeLa cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27392-1-AP targets OTULIN in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22302

Product name: Recombinant human FAM105B protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-214 aa of BC007706

Sequence: MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL

Predict reactive species
Full Name family with sequence similarity 105, member B
Calculated Molecular Weight 352 aa, 40 kDa
Observed Molecular Weight40-50 kDa
GenBank Accession NumberBC007706
Gene Symbol FAM105B
Gene ID (NCBI) 90268
RRIDAB_3085952
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96BN8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Linear ubiquitination is negatively regulated by OTULIN (OTU deubiquitinase with linear linkage specificity, also known as Fam105b or Gumby), a deubiquitinase specifically catalysing the degradation of linear ubiquitin chains. OUb signalling is antagonised by deubiquitinases (DUBs), which cleave the polyUb signal from substrates to terminate signalling. OTU DUB with linear linkage specificity (OTULIN) and CYLD are the two main DUBs that regulate M1-polyUb signalling. OTULIN exclusively cleaves M1 linkages, whereas CYLD cleaves both M1 and K63 linkages. OTULIN binds directly to the LUBAC subunit HOIP and regulates LUBAC signalling, autoubiquitination, and stability.(PMID: 34625557, PMID: 32231246)

Protocols

Product Specific Protocols
WB protocol for OTULIN antibody 27392-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The OTULIN Polyclonal antibody (Cat# 27392-1-AP) has 1 total citation. The cited publication appeared in Cellular and Molecular Biology Letters (Impact Factor: 12.2), published in 2026. The research focuses on neonatal lung injury protection by OTULIN under hyperoxia conditions, involving mitochondrial protein OPA1 modulation and its association with the E3 ubiquitin ligase RNF31. The study falls within the fields of pulmonary biology, mitochondrial function, and ubiquitin signaling.

SpeciesApplicationTitle

Cell Mol Biol Lett

OTULIN protects hyperoxia-induced neonatal lung injury and modulates mitochondrial protein OPA1 in association with the E3 ubiquitin ligase RNF31.

Authors - Li Huang
Loading...
||
New chat

Able™

正在加载,请稍候...