FAM108C1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM108C1 Polyclonal antibody, PBS Only (33561-1-PBS)

• 

  WB analysis using 33561-1-AP (same clone as 33561-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33561-1-AP (FAM108C1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33561-1-PBS in a different storage buffer formulation.

FAM108C1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33561-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ABHD17C, Abhydrolase domain-containing protein 17C, Alpha/beta hydrolase domain-containing protein 17C, EC:3.1.2.22

---

Product Information

33561-1-PBS targets FAM108C1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37831

  Product name: Recombinant human FAM108C1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-91 aa of BC059401

  Sequence: RMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPAQATAAAAAAQPAPQQPEEGAGAGPGACSLHL

• Full Name: family with sequence similarity 108, member C1
• Calculated Molecular Weight: 329 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC059401
• Gene Symbol: FAM108C1
• Gene ID (NCBI): 58489
• RRID: AB_3743008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6PCB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.