FAM114A1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• FAM114A1 Monoclonal antibody (67926-1-Ig)

FAM114A1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67926-1-Ig Copied!

Clone No. 1B11D6

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1B11D6, Growth hormone, Nervous system overexpressed protein 20, NOXP20, Protein FAM114A1

• 

  WB analysis using 67926-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67926-1-Ig (FAM114A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 67926-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67926-1-Ig (FAM114A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U2OS using 67926-1-Ig

  U2OS cells were subjected to SDS PAGE followed by western blot with 67926-1-Ig (FAM114A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-12 using 67926-1-Ig

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67926-1-Ig (FAM114A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 67926-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67926-1-Ig (FAM114A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67926-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FAM114A1 antibody (67926-1-Ig, Clone: 1B11D6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 67926-1-Ig

  Biolayer interferometry (BLl) kinetic assays of 67926-1-Ig against Human FAM114A1 were performed. The affinity constant is 0.126 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FAM114A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U2OS cells, PC-12 cells, NIH/3T3 cells, A549 cells, HepG2 cells, LNCaP cells, HeLa cells, HSC-T6 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67926-1-Ig targets FAM114A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17289

  Product name: Recombinant human FAM114A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 305-538 aa of BC040452

  Sequence: LEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLTTAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYI

• Full Name: family with sequence similarity 114, member A1
• Calculated Molecular Weight: 563 aa, 61 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC040452
• Gene Symbol: FAM114A1
• Gene ID (NCBI): 92689
• RRID: AB_2918678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWE2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM114A1, also named as Nervous system overexpressed protein 20, is a 563 amino acid protein, which belongs to the FAM114 family. FAM114A1 localizes in the cytoplasm and may play a role in neuronal cell development. The calculated molecular weight of FAM114A1 is 61 kDa, but the modified FAM114A1 may be 70-80 kDa protein.

Publications

What published studies show

The FAM114A1 Monoclonal antibody (1B11D6), catalog number 67926-1-Ig, has 1 total citation. The cited publication appeared in Frontiers in Oncology (2021) and investigated glioma pathogenesis via the VEGF signaling pathway. The research field is oncology, specifically brain tumor biology. In the study, the antibody was applied by IHC in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; RAB42 Promotes Glioma Pathogenesis via the VEGF Signaling Pathway.; Authors - Baoling Liu