FAM114A1 Monoclonal antibody, PBS Only (Capture)

FAM114A1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 67926-1-PBS
Clone No.1B11D6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Protein NOXP20, Protein FAM114A1, NOXP20, Nervous system overexpressed protein 20, 1B11D6

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67926-1-PBS targets FAM114A1 as part of a matched antibody pair:

MP51192-1: 67926-1-PBS capture and 67926-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17289

Product name: Recombinant human FAM114A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 305-538 aa of BC040452

Sequence: LEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLTTAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYI

Predict reactive species
Full Name family with sequence similarity 114, member A1
Calculated Molecular Weight 563 aa, 61 kDa
Observed Molecular Weight80 kDa
GenBank Accession NumberBC040452
Gene Symbol FAM114A1
Gene ID (NCBI) 92689
RRIDAB_2918678
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IWE2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FAM114A1, also named as Nervous system overexpressed protein 20, is a 563 amino acid protein, which belongs to the FAM114 family. FAM114A1 localizes in the cytoplasm and may play a role in neuronal cell development. The calculated molecular weight of FAM114A1 is 61 kDa, but the modified FAM114A1 may be 70-80 kDa protein.

Loading...
||
New chat Able
正在加载,请稍候...