FAM116A Recombinant monoclonal antibody

• 

  WB analysis of PC-3 using 83473-3-RR

  PC-3 cells were subjected to SDS PAGE followed by western blot with 83473-3-RR (FAM116A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 83473-3-RR

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 83473-3-RR (FAM116A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HepG2 using 83473-3-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug FAM116A Recombinant antibody (83473-3-RR, Clone:240486B9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83473-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83473-3-RR against Human FAM116A were performed. The affinity constant is 1.43 nM.

FAM116A Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83473-3-RR

Clone No.240486B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

DENND6A, 240486B9, DENN domain-containing protein 6A, Protein DENND6A, Protein FAM116A

---

Tested Applications

• Positive WB detected in: PC-3 cells, HEK-293 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83473-3-RR targets FAM116A in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22052

  Product name: Recombinant human FAM116A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-60 aa of BC040291

  Sequence: MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSA

• Full Name: family with sequence similarity 116, member A
• Calculated Molecular Weight: 608 aa, 70 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC040291
• Gene Symbol: FAM116A
• Gene ID (NCBI): 201627
• RRID: AB_3671102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWF6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM116A has DENN-related domains, which are required for cell migration.