FAM119B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM119B Polyclonal antibody, PBS Only (33982-1-PBS)

• 

  WB analysis using 33982-1-AP (same clone as 33982-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33982-1-AP (FAM119B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33982-1-PBS in a different storage buffer formulation.

FAM119B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33982-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EC:2.1.1.-, EEF1A lysine methyltransferase 3, EEF1AKMT3, eEF1A-KMT3, HCA557A

---

Product Information

33982-1-PBS targets FAM119B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40880

  Product name: Recombinant human FAM119B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC099841

  Sequence: MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQ

• Full Name: family with sequence similarity 119, member B
• Calculated Molecular Weight: 226 aa, 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC099841
• Gene Symbol: FAM119B
• Gene ID (NCBI): 25895
• RRID: AB_3743132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96AZ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EEF1AKMT3 (also known as METTL21B or FAM119B) is a gene that encodes a member of the methyltransferase-like (METTL) protein family. This enzyme functions as a specific lysine methyltransferase, with its primary and well-characterized substrate being eukaryotic translation elongation factor 1 alpha (eEF1A).