FAM126A Polyclonal antibody

• 

  WB analysis of K-562 using 26243-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26243-1-AP (FAM126A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 26243-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 26243-1-AP (FAM126A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FAM126A Polyclonal Antibody for WB, ELISA

Cat No. 26243-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DRCTNNB1A, FAM126A, HCC, HLD5, HYCC1, Hyccin, Protein FAM126A

---

Tested Applications

• Positive WB detected in: K-562 cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

26243-1-AP targets FAM126A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24004

  Product name: Recombinant human FAM126A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 284-521 aa of BC018710

  Sequence: ASLPHGPMKSNKEGTRCIQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGESCKDHFARKQTQRAQSENLELLSLKRLTLTTSQSLPKPSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQRPPSISITLSTD

• Full Name: family with sequence similarity 126, member A
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC018710
• Gene Symbol: FAM126A
• Gene ID (NCBI): 84668
• RRID: AB_2880443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogene; YEATS2 promotes DNA repair and induces anoikis resistance by enhancing chromatin accessibility to drive prostate cancer metastasis.; Authors - Haoran Li
human	WB	iScience; Frequent loss of FAM126A expression in colorectal cancer results in selective FAM126B dependency; Authors - Shuang Li ; KO Validated