FAM160B1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• FAM160B1 Recombinant monoclonal antibody (86980-1-RR)

• 

  WB analysis of PC-3 using 86980-1-RR

  PC-3 cells were subjected to SDS PAGE followed by western blot with 86980-1-RR (FAM160B1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 86980-1-RR

  human testis tissue were subjected to SDS PAGE followed by western blot with 86980-1-RR (FAM160B1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86980-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86980-1-RR against Human FAM160B1 were performed. The affinity constant is 0.452 nM.

FAM160B1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86980-1-RR

Clone No.252114F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FHF complex subunit HOOK interacting protein 2A, FHIP2A

---

Tested Applications

• Positive WB detected in: human testis tissue, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86980-1-RR targets FAM160B1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22051

  Product name: Recombinant human FAM160B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 136-319 aa of BC037207

  Sequence: IRLCGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHLSTSLDNLSVTSLPEASVVCPNQDYNLVNSLLNLTRSPDGRIAVKACEGLMLLVSLPEPAAAKCLTQSTCLCELLTDRLASLYKA

• Full Name: family with sequence similarity 160, member B1
• Calculated Molecular Weight: 765 aa, 86 kDa
• Observed Molecular Weight: 100, 130 kDa
• GenBank Accession Number: BC037207
• Gene Symbol: FAM160B1
• Gene ID (NCBI): 57700
• RRID: AB_3745252
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5W0V3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM160B1, also named as KIAA1600, is a 765 amino acid protein, which belongs to the UPF0518 family. The biological function of FAM160B1is still non-known. FAM160B1 exists as two isoforms and the molecular weight of isoform one is a 86 kDa protein.The isoforms two is produced by alternative splicing and is a 83 kDa protein. There are modified residues of FAM160B1 protein, so we detected 95 kDa and 100 kDa two bands by western blotting.