Use Able AI chat for product recommendations

FAM172A Polyclonal antibody, PBS Only

FAM172A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24732-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

24732-1-PBS targets FAM172A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20437

Product name: Recombinant human FAM172A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 202-416 aa of BC020584

Sequence: NYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL

Predict reactive species
Full Name family with sequence similarity 172, member A
Calculated Molecular Weight 416 aa, 48 kDa
Observed Molecular Weight50-55 kDa
GenBank Accession NumberBC020584
Gene Symbol FAM172A
Gene ID (NCBI) 83989
RRIDAB_2923572
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WUF8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Family with sequence similarity 172 member A (FAM172A), cloned from human aortic tissues, is subsequently observed in human endothelial and vascular smooth muscle cells, and macrophages. As the imbalance of the cell cycle and apoptosis is closely related to the key characteristics of malignant tumors, FAM172A dysregulation is a potential contributing factor in cell transformation. Recently, FAM172A has been reported to take part in the development of several cancers, such as human liver, colorectal and papillary thyroid cancers. Moreover, FAM172A was upregulated by high glucose in a concentration- and time-dependent manner which indicated that FAM172A may be involved in the pathogenesis of diabetic related diseases. FAM172A has 4 isoforms with the molecular mass of 34-36, 43 and 48 kDa. This antibody was detected at 50-55 kDa on SDS-PAGE. (PMID: 31988090, 26637224)

Loading...
||
New chat

Able

正在加载,请稍候...