FAM173A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM173A Polyclonal antibody, PBS Only (32901-1-PBS)

• 

  IHC staining of mouse kidney using 32901-1-AP (same clone as 32901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32901-1-AP (FAM173A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32901-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 32901-1-AP (same clone as 32901-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32901-1-AP (FAM173A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32901-1-PBS in a different storage buffer formulation.

FAM173A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 32901-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Adenine nucleotide translocase lysine N-methyltransferase, ANTKMT , ANT-KMT, C16orf24, EC:2.1.1.-

---

Product Information

32901-1-PBS targets FAM173A in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37690

  Product name: Recombinant human FAM173A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-235 aa of BC001181

  Sequence: QPGFRRVPLRLQVPYVGASARQVEHVLSLLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAAPGPSSAPIPGGLISQAS

• Full Name: family with sequence similarity 173, member A
• Calculated Molecular Weight: 235 aa, 25 kDa
• GenBank Accession Number: BC001181
• Gene Symbol: FAM173A
• Gene ID (NCBI): 65990
• RRID: AB_3742781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BQD7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ANTKMT (FAM173A) encodes adenine nucleotide translocase lysine methyltransferase, a protein-lysine methyltransferase that carries out peptidyl-lysine trimethylation. It is a member of the 7BS protein lysine methyltransferase and ANT/ATPSC lysine N-methyltransferase families. The protein localizes to the mitochondrion, mitochondrial membrane, cytosol, and membrane, placing it in compartments relevant to mitochondrial energy metabolism.