EVA1A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EVA1A Polyclonal antibody (26726-1-AP)

• Featured Product
• KD/KO Validated

EVA1A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26726-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

FAM176A, Protein eva-1 homolog A, Protein FAM176A, SP24, TMEM166

• 

  WB analysis using 26726-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26726-1-AP (EVA1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26726-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26726-1-AP (EVA1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 26726-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 26726-1-AP (FAM176A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 26726-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 26726-1-AP (FAM176A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EVA1A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse liver tissue, HeLa cells, rat liver tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26726-1-AP targets EVA1A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24990

  Product name: Recombinant human FAM176A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-108 aa of BC063016

  Sequence: ISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLN

• Full Name: family with sequence similarity 176, member A
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC063016
• Gene Symbol: FAM176A
• Gene ID (NCBI): 84141
• RRID: AB_2880615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8M9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EVA1A polyclonal antibody (Cat# 26726-1-AP) has 1 citation. It appears in Cardiovascular Research (IF 12.5, 2020), in a study demonstrating that Eva1a ameliorates atherosclerosis by promoting re-endothelialization of injured arteries via the Rac1/Cdc42/Arpc1b pathway. The antibody was used for Western blot in mouse samples. The associated research field is cardiovascular biology, specifically atherosclerosis and endothelial repair.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cardiovasc Res; Eva1a ameliorates atherosclerosis by promoting re-endothelialization of injured arteries via Rac1/Cdc42/Arpc1b.; Authors - Jingxuan Li ; KD Validated