EVA1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EVA1A Polyclonal antibody, PBS Only (26726-1-PBS)

• Featured Product
• KD/KO Validated

EVA1A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26726-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

FAM176A, Protein eva-1 homolog A, Protein FAM176A, SP24, TMEM166

• 

  WB analysis using 26726-1-AP (same clone as 26726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26726-1-AP (EVA1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26726-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26726-1-AP (same clone as 26726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26726-1-AP (EVA1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26726-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 26726-1-AP (same clone as 26726-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 26726-1-AP (FAM176A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26726-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 26726-1-AP (same clone as 26726-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 26726-1-AP (FAM176A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26726-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EVA1A in ?

Chat with Able

---

Product Information

26726-1-PBS targets EVA1A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24990

  Product name: Recombinant human FAM176A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-108 aa of BC063016

  Sequence: ISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLN

• Full Name: family with sequence similarity 176, member A
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC063016
• Gene Symbol: FAM176A
• Gene ID (NCBI): 84141
• RRID: AB_2880615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8M9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.