Filter: AllIHC

IHC staining of human pancreas using 26726-1-AP (same clone as 26726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 26726-1-AP (EVA1A Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26726-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 26726-1-AP (same clone as 26726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 26726-1-AP (EVA1A Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26726-1-PBS in a different storage buffer formulation.

EVA1A Polyclonal antibody, PBS Only

Name: EVA1A Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 26726-1-PBS

EVA1A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26726-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Transmembrane protein 166, TMEM166, SP24, Protein FAM176A, Protein eva-1 homolog A

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

26726-1-PBS targets EVA1A in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag24990 Product name: Recombinant human FAM176A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 57-108 aa of BC063016 Sequence: ISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLN Predict reactive species
Full Name	family with sequence similarity 176, member A
Calculated Molecular Weight	17 kDa
GenBank Accession Number	BC063016
Gene Symbol	FAM176A
Gene ID (NCBI)	84141
RRID	AB_2880615
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H8M9
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™