FAM190B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM190B Polyclonal antibody, PBS Only (21078-1-PBS)

• 

  WB analysis using 21078-1-AP (same clone as 21078-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21078-1-AP (FAM190B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 21078-1-AP (same clone as 21078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21078-1-AP (FAM190B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 21078-1-AP (same clone as 21078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21078-1-AP (FAM190B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21078-1-PBS in a different storage buffer formulation.

FAM190B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21078-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

KIAA1128, Gcap14, Protein FAM190B, Protein GCAP14 homolog

---

Product Information

21078-1-PBS targets FAM190B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15281

  Product name: Recombinant human KIAA1128 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC030528

  Sequence: MPNGTPVNLLGTSKNSNVKSYIKNNGSDCPSSHSFNWRKANKYQLCAQGVEEPNNTQNSHDKIIDPEKRVPTQGMFDKNGIKGGLKSVSLFTSKLAKPSTMFVSSTEELNQKSFSGPSNLGKFTKGTLLGRTSYSSINTPKSQLNGFYGNRSAGSMQRPRANSCATRSSSGESLAQSPDSSKSINCEKMVRSQSFSHSIQNSFLPPSSITRSHSFNRAVDLTKPYQNQQLSIRVPLRSSMLTRNSRQPEVLNGNEHLGYGFNRPYAAGGKKLALPNGPGVTSTLGYRMVHPSLLKSSRSPFSGTMTVDGNKNSPADTCVEEDATVLAKDRAANKDQELIENESYRTKNNQTMKH

• Full Name: KIAA1128
• Calculated Molecular Weight: 834 aa, 94 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC030528
• Gene Symbol: KIAA1128
• Gene ID (NCBI): 54462
• RRID: AB_3742014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7U1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM190B (Family with sequence similarity 190, member B), also known as Gcap14, CCSER2, KIAA1128, NPD012, is a CC domain-containing protein with multiple isoforms generated by alternative splicing that functions as an MAP. FAM190B is a microtubule plus-end-tracking protein and as a regulator of microtubule dynamics during neurodevelopment (PMID: 36795749).