FAM210A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM210A Polyclonal antibody, PBS Only (31694-1-PBS)

• 

  WB analysis using 31694-1-AP (same clone as 31694-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31694-1-AP (FAM210A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31694-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 31694-1-AP (same clone as 31694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31694-1-AP (FAM210A antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31694-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 31694-1-AP (same clone as 31694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31694-1-AP (FAM210A antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31694-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31694-1-AP (same clone as 31694-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FAM210A antibody (31694-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31694-1-PBS in a different storage buffer formulation.

FAM210A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31694-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C18orf19

---

Product Information

31694-1-PBS targets FAM210A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36161

  Product name: Recombinant human C18orf19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 157-272 aa of NM_001098801

  Sequence: LKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE

• Full Name: chromosome 18 open reading frame 19
• Calculated Molecular Weight: 30kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_001098801
• Gene Symbol: C18orf19
• Gene ID (NCBI): 125228
• RRID: AB_3670081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96ND0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM210A also known as C18orf19, is a determinant of bone and muscle structure and strength. FAM210A is required for cold-induced mitochondrial cristae remodeling, adaptive thermogenic activity, and brown adipose tissue characteristics(PMID: 37816711). FAM210A is localized to mitochondria and cytoplasm of muscle cells and myotubes(PMID: 29618611).