Product Information
20588-1-PBS targets FAM3A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14343 Product name: Recombinant human FAM3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-197 aa of BC002934 Sequence: GRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPF Predict reactive species |
| Full Name | family with sequence similarity 3, member A |
| Calculated Molecular Weight | 230 aa, 25 kDa |
| Observed Molecular Weight | 25-27 kDa |
| GenBank Accession Number | BC002934 |
| Gene Symbol | FAM3A |
| Gene ID (NCBI) | 60343 |
| RRID | AB_2878704 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P98173 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







