FAM3A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM3A Polyclonal antibody, PBS Only (20588-1-PBS)

• 

  WB analysis using 20588-1-AP (same clone as 20588-1-PBS)

  Mouse liver tissues were subjected to SDS PAGE followed by western blot with 20588-1-AP (FAM3A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20588-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20588-1-AP (same clone as 20588-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20588-1-AP (FAM3A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20588-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 20588-1-AP (same clone as 20588-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 20588-1-AP (FAM3A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20588-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 20588-1-AP (same clone as 20588-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 20588-1-AP (FAM3A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20588-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FAM3A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20588-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

20588-1-PBS targets FAM3A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14343

  Product name: Recombinant human FAM3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-197 aa of BC002934

  Sequence: GRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPF

• Full Name: family with sequence similarity 3, member A
• Calculated Molecular Weight: 230 aa, 25 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC002934
• Gene Symbol: FAM3A
• Gene ID (NCBI): 60343
• RRID: AB_2878704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P98173
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.