FAM46A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM46A Polyclonal antibody, PBS Only (31006-1-PBS)

• 

  WB analysis using 31006-1-AP (same clone as 31006-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31006-1-AP (FAM46A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31006-1-PBS in a different storage buffer formulation.

FAM46A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31006-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

XTP11, Terminal Nucleotidyltransferase 5A, OI18, C6orf37

---

Product Information

31006-1-PBS targets FAM46A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33896

  Product name: Recombinant human FAM46A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-82 aa of BC000683

  Sequence: MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI

• Full Name: family with sequence similarity 46, member A
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC000683
• Gene Symbol: FAM46A
• Gene ID (NCBI): 55603
• RRID: AB_3669813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IP4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM46A, also known as TENT5A, is a member of the FAM46 subfamily of the nucleotidyltransferase fold superfamily. It has two isoforms and has been implicated in several human diseases including retinitis pigmentosa, bone abnormalities, cancer and obesity (PMID: 32528962).