FAM47B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM47B Polyclonal antibody, PBS Only (24467-1-PBS)

• 

  WB analysis using 24467-1-AP (same clone as 24467-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24467-1-AP (FAM47B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24467-1-PBS in a different storage buffer formulation.

FAM47B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24467-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24467-1-PBS targets FAM47B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21562

  Product name: Recombinant human FAM47B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 308-412 aa of BC035026

  Sequence: RPEPSKTQVSSLCPEPPEAGVSHLCLEPPNTHRVSSFLLQVLKLDSEKKLEDARARCEGQEMTTEELTKPGKYHFWESCPRPFESRMPHLRLVLPITRRMASLCL

• Full Name: family with sequence similarity 47, member B
• Calculated Molecular Weight: 645 aa, 74 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC035026
• Gene Symbol: FAM47B
• Gene ID (NCBI): 170062
• RRID: AB_3669438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NA70
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM47B(Family with sequence similarity 47 member B) belongs to the FAM47 family and is expressed in testis.