Product Information
32882-1-PBS targets FAM76B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36658 Product name: Recombinant human FAM76B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 179-277 aa of NM_144664.4 Sequence: HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKL Predict reactive species |
| Full Name | family with sequence similarity 76, member B |
| Calculated Molecular Weight | 39kDa，339aa |
| Observed Molecular Weight | 36-39 kDa |
| GenBank Accession Number | NM_144664.4 |
| Gene Symbol | FAM76B |
| Gene ID (NCBI) | 143684 |
| RRID | AB_3742775 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q5HYJ3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FAM76B is a nuclear protein with a molecular weight of about 39 kDa. Its amino acid sequence is highly conserved, and it is highly similar to FAM76B sequence of rats, mice and zebrafish. The protein contains histidine repeat sequence (poly-His domain) and ubiquitination site of Lys-225. FAM76B inhibits the inflammatory reaction mediated by NF-κB by affecting the cytoplasmic translocation of hnRNPA2B1. The expression of inflammatory factors (such as IL-6) increased significantly in FAM76B gene knockout mice, indicating that FAM76B has anti-inflammatory effect.
