FAM82B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM82B Polyclonal antibody, PBS Only (24919-1-PBS)

• 

  WB analysis using 24919-1-AP (same clone as 24919-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24919-1-AP (FAM82B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24919-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 24919-1-AP (same clone as 24919-1-PBS)

  IP result of anti-FAM82B (IP:24919-1-AP, 4ug; Detection:24919-1-AP 1:600) with HeLa cells lysate 1760 ug. This data was developed using the same antibody clone with 24919-1-PBS in a different storage buffer formulation.

FAM82B Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24919-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

CGI 90, hRMD 1, Protein FAM82B, RMD 1, RMD1

---

Product Information

24919-1-PBS targets FAM82B in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20679

  Product name: Recombinant human FAM82B protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-314 aa of BC009671

  Sequence: MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSALSYLGFETYQVISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEKN

• Full Name: family with sequence similarity 82, member B
• Calculated Molecular Weight: 314 aa, 36 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC009671
• Gene Symbol: FAM82B
• Gene ID (NCBI): 51115
• RRID: AB_3742128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DB5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM82B, also known as RMDN1 or CGI90, belongs to the FAM82/RMD family. FAM82B is a microtubule-associated protein with potential roles in regulating microtubule dynamics and other cellular functions.