Use Able AI chat for product recommendations

FAM83H Polyclonal antibody, PBS Only

FAM83H Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Protein FAM83H

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

31974-1-PBS targets FAM83H in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag37139

Product name: Recombinant human FAM83H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1000-1179 aa of BC033256

Sequence: RRLSLGQGDSTEAATEERGPRARLSSATANALYSSNLRDDTKAILEQISAHGQKHRAVPAPSPGPTHNSPELGRPPAAGVLAPDMSDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTFKSKK

Predict reactive species
Full Name family with sequence similarity 83, member H
Calculated Molecular Weight127 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC033256
Gene Symbol FAM83H
Gene ID (NCBI) 286077
RRIDAB_3742503
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ6ZRV2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FAM83H was first discovered during extensive computational analysis of the human genomic sequence [PMID: 18252228] and reported to be essential in dental enamel formation [PMID: 26142250, PMID: 21127961]. Mutation of FAM83H is the main etiological factor for human autosomal dominant hypocalcified amelogenesis imperfecta. Moreover, recently, research into FAM83H has focused on its roles in the development and progression of human cancers. However, there are controversial reports for the role of FAM83H in human cancers. Earlier reports, which used microarray analysis, showed higher FAM83H expression in ovarian cancers compared with normal ovarian tissue [PMID: 21617380]. In addition, higher expression of the FAM83H gene is presented in the cancers of lung, breast, colon, liver, ovary, pancreas, and stomach [PMID: 28078827]. The roles of FAM83H in the progression of human cancers involve changes in the proliferation and invasiveness of cancer cells. In colon cancer cells, overexpression of FAM83H is suggested to be involved in the progression of cancer cells by disorganizing keratin cytoskeleton structures [PMID: 23902688, PMID: 27681590]. In addition, FAM83H increases proliferation of prostatic cancer cells [PMID: 26512949], hepatocellular carcinoma cells [PMID: 28607447], and clear cell renal cell carcinoma cells [PMID: 30723706]. In hepatocellular carcinoma cells, activation of the MYC-FAM83H pathway increases the proliferation and invasion activity of cancer cells [PMID: 28607447]. Moreover, higher expression of FAM83H is associated with an increased recurrence rate of prostatic cancer patients and shorter survival of uterine cancer [PMID: 28078827], hepatocellular carcinoma [PMID: 28607447], and clear cell renal cell carcinoma patients [PMID: 21057535]. These findings suggest that FAM83H has a vital role in tumorigenesis and progression of human malignant tumors, and might be involved in the progression of various types of human cancers. However, the expression of FAM83H is down-regulated in astrocytoma and oligodendroglioma of the brain, and higher expression of FAM83H is associated with favorable prognosis of glioma and head and neck cancer patients [PMID: 28078827]. Therefore, there is a possibility that the role of FAM83H might be different according to the type of cells and further study is needed [PMID: 21057535].

Loading...
||
New chat

Able

正在加载,请稍候...