FAM92A1 Polyclonal antibody

• 

  WB analysis of HeLa using 24803-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24803-1-AP (FAM92A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 24803-1-AP

  IP result of anti-FAM92A1 (IP:24803-1-AP, 4ug; Detection:24803-1-AP 1:500) with HeLa cells lysate 4000ug.

• 

  IHC staining of human renal cell carcinoma using 24803-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 24803-1-AP (FAM92A1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human renal cell carcinoma using 24803-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 24803-1-AP (FAM92A1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 24803-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using FAM92A1 antibody (24803-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FAM92A1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 24803-1-AP

Publications(6)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CIBAR1, FAM92A, CBY1-interacting BAR domain-containing protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IF: See 5 publications below

Product Information

24803-1-AP targets FAM92A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20738

  Product name: Recombinant human FAM92A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 162-318 aa of BC014598

  Sequence: ATLTARNREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQEAGWAATCQTLI

• Full Name: family with sequence similarity 92, member A1
• Calculated Molecular Weight: 289 aa, 33 kDa
• Observed Molecular Weight: 29-33 kDa
• GenBank Accession Number: BC014598
• Gene Symbol: FAM92A1
• Gene ID (NCBI): 137392
• RRID: AB_2879735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1XBS5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
HUMAN	WB,IF	Mol Cell Biol; BAR Domain-Containing FAM92 Proteins Interact with Chibby1 to Facilitate Ciliogenesis.; Authors - Feng-Qian Li ; KD Validated
mouse	WB,IF	Life Sci Alliance; ciBAR1 loss in mice causes laterality defects, pancreatic degeneration, and altered glucose tolerance; Authors - Eunice N Kim
human	IF	J Exp Clin Cancer Res; Nuclear FAM289-Galectin-1 interaction controls FAM289-mediated tumor promotion in malignant glioma.; Authors - Xing Rong Guo
human	WB	Am J Hum Genet; Mutations in SCNM1 cause orofaciodigital syndrome due to minor intron splicing defects affecting primary cilia; Authors - Asier Iturrate
human	IF	Adv Sci (Weinh); The ARPKD Protein DZIP1L Regulates Ciliary Protein Entry by Modulating the Architecture and Function of Ciliary Transition Fibers; Authors - Huicheng Chen
mouse	WB,IF	Nat Commun; Membrane remodeling by FAM92A1 during brain development regulates neuronal morphology, synaptic function, and cognition; Authors - Liang Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ken (Verified Customer) (12-03-2018)

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: 1:1000 for both applications
• Cell Tissue Type: various tissue culture cells