FAM96A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM96A Polyclonal antibody, PBS Only (20776-1-PBS)

• 

  IP experiment of THP-1 using 20776-1-AP (same clone as 20776-1-PBS)

  IP result of anti-FAM96A (IP:20776-1-AP, 4ug; Detection:20776-1-AP 1:600) with THP-1 cells lysate 2400 ug. This data was developed using the same antibody clone with 20776-1-PBS in a different storage buffer formulation.

• 

  IP experiment of U-937 using 20776-1-AP (same clone as 20776-1-PBS)

  IP result of anti-FAM96A (IP:20776-1-AP, 4ug; Detection:20776-1-AP 1:600) with U-937 cells lysate 2240 ug. This data was developed using the same antibody clone with 20776-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 20776-1-AP (same clone as 20776-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 20776-1-AP (FAM96A antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20776-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 20776-1-AP (same clone as 20776-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 20776-1-AP (FAM96A antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20776-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 20776-1-AP (same clone as 20776-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using FAM96A antibody (20776-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20776-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 20776-1-AP (same clone as 20776-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using FAM96A antibody (20776-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20776-1-PBS in a different storage buffer formulation.

FAM96A Polyclonal Antibody for IHC, IF/ICC, IP, Indirect ELISA

Cat No. 20776-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CIA2A, CIAO2A, Cytosolic iron-sulfur assembly component 2A, MIP18 family protein FAM96A, Protein FAM96A

---

Product Information

20776-1-PBS targets FAM96A in IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14770

  Product name: Recombinant human FAM96A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC008865

  Sequence: MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHC

• Full Name: family with sequence similarity 96, member A
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 18-21 kDa
• GenBank Accession Number: BC008865
• Gene Symbol: FAM96A
• Gene ID (NCBI): 84191
• RRID: AB_3669346
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5X1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM96A (family with sequence similarity 96, member A), also called cytosolic iron-sulfur assembly component 2A (CIAO2A), a recently identified member of the cytosolic iron-sulfur (Fe/S) protein assembly machinery and regulator of cellular iron homeostasis, is a novel pro-apoptotic APAF1-binding protein facilitating the effective induction of cell death via the mitochondrial apoptosis pathway. FAM96A is substantially enriched in macrophages comprised primarily of a DUF59 domain (residues 31-157) and an N-terminal signal peptide (residues 1-27), that is expressed at low levels in tumor cells (PMID: 29399066).