FAM98B Polyclonal antibody

• 

  WB analysis using 22251-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22251-1-AP (FAM98B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22251-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22251-1-AP (FAM98B antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 22251-1-AP

  IP result of anti-FAM98B (IP:22251-1-AP, 4ug; Detection:22251-1-AP 1:5000) with HepG2 cells lysate 1480 ug.

• 

  IHC staining of human breast cancer using 22251-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 22251-1-AP (FAM98B Antibody) at dilution of 1:50.

• 

  IHC staining of human breast cancer using 22251-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 22251-1-AP (FAM98B Antibody) at dilution of 1:50.

• 

  IF Staining of HepG2 using 22251-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FAM98B antibody (22251-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

FAM98B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22251-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Protein FAM98B

---

Tested Applications

• Positive WB detected in: HepG2 cells, Caco-2 cells, Raji cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

22251-1-AP targets FAM98B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17747

  Product name: Recombinant human FAM98B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-186 aa of BC093898

  Sequence: LEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQ

• Full Name: family with sequence similarity 98, member B
• Calculated Molecular Weight: 330 aa, 37 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC093898
• Gene Symbol: FAM98B
• Gene ID (NCBI): 283742
• RRID: AB_2879049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q52LJ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM98B (Family with Sequence Similarity 98 Member B) is a protein-coding gene that has been identified as a component of the human tRNA ligase complex (tRNA-LC), which plays a crucial role in tRNA splicing, RNA repair, and other cellular processes. FAM98B contains a glycine-rich intrinsically disordered region (IDR) that can aggregate, leading to the formation of pathological aggregates associated with neurodegenerative diseases. In a study, FAM98B was found to be depleted in patient tissues with abnormal tRNA splicing intermediates, indicating its role in these diseases. (PMID: 34854379, PMID: 40674500)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Commun Biol; DDX1 is required for non-spliceosomal splicing of tRNAs but not of XBP1 mRNA; Authors - Teruhiko Suzuki
human	WB	Cell Discov; NUDT21 lactylation reprograms alternative polyadenylation to promote cuproptosis resistance; Authors - Jinlong Lin