• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Fas/CD95 Polyclonal antibody

Fas/CD95 Polyclonal Antibody for
Cat No. CL488-13098

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FAS, CD95, APT1, Apoptosis-mediating surface antigen FAS, Apo-1 antigen

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-13098 targets Fas/CD95 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3718

Product name: Recombinant human FAS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 156-335 aa of BC012479

Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

Predict reactive species
Full Name Fas (TNF receptor superfamily, member 6)
Calculated Molecular Weight 35-38 kDa
Observed Molecular Weight 38-45 kDa
GenBank Accession NumberBC012479
Gene Symbol Fas/CD95
Gene ID (NCBI) 355
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25445
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Fas (CD95/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation.

Loading...
||
New chat

Able

正在加载,请稍候...