CoraLite® Plus 488-conjugated FBP2 Recombinant monoclonal antibody

FBP2 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-83910-5
Clone No.240879C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Muscle FBPase, Fructose-1,6-bisphosphatase isozyme 2, FBPase 2, EC:3.1.3.11, D-fructose-1,6-bisphosphate 1-phosphohydrolase 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83910-5 targets FBP2 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18245

Product name: Recombinant human FBP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 283-339 aa of BC113632

Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS

Predict reactive species
Full Name fructose-1,6-bisphosphatase 2
Calculated Molecular Weight 339 aa, 37 kDa
Observed Molecular Weight37 kDa
GenBank Accession NumberBC113632
Gene Symbol FBP2
Gene ID (NCBI) 8789
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00757
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FBP2, also named muscle FBP, belongs to the FBPase class 1 family. FBP2 is a ubiquitously expressed enzyme of glycogen synthesis from non-carbohydrates, e.g., lactate (glyconeogenesis). However, it also plays a variety of non-enzymatic functions. FBP2 is involved in the regulation of hypoxia-inducible factor 1 (Hif1) stability, cell cycle-dependent events, biogenesis of mitochondria, and protection of the organelles against high reactive oxygen species (ROS)- and high Ca2+-induced stress (PMID: 32962293, PMID: 35626746). The calculated molecular weight of FBP2 is 37 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FBP2 antibody CL488-83910-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...