FBXL20 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FBXL20 Polyclonal antibody (20949-1-AP)

• 

  WB analysis using 20949-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 20949-1-AP (FBXL20 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 20949-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using FBXL20 antibody (20949-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

FBXL20 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 20949-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Fbl2, Fbl20

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20949-1-AP targets FBXL20 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15071

  Product name: Recombinant human FBXL20 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 80-436 aa of BC007557

  Sequence: RVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL

• Full Name: F-box and leucine-rich repeat protein 20
• Calculated Molecular Weight: 436 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC007557
• Gene Symbol: FBXL20
• Gene ID (NCBI): 84961
• RRID: AB_3742010
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IG2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXL20 (F-box and leucine-rich repeat protein 20) is a member of the F-box protein family, which plays a crucial role in the ubiquitin-proteasome system. FBXL20 acts as a substrate recognition component of the SCF (Skp1-Cul1-F-box) ubiquitin ligase complex, targeting specific proteins for ubiquitination and subsequent degradation. This protein is involved in cell cycle regulation, signal transduction, and maintenance of protein homeostasis. Abnormal expression of FBXL20 has been implicated in various diseases, including cancer and neurodegenerative disorders. Research also suggests that FBXL20 may regulate the degradation of 4-1BB, an important immune stimulator, through ubiquitination. (PMID: 25593308, PMID: 27502938, PMID: 35112462)