FBXO16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FBXO16 Polyclonal antibody (32063-1-AP)

• 

  WB analysis using 32063-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32063-1-AP (FBXO16 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of T-47D using 32063-1-AP

  IP result of anti-FBXO16 (IP:32063-1-AP, 4ug; Detection:32063-1-AP 1:1000) with T-47D cells lysate 1120 ug.

FBXO16 Polyclonal Antibody for WB, IP, ELISA

Cat No. 32063-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

F box only protein 16, F box protein 16, FBX16

---

Tested Applications

• Positive WB detected in: MCF-7 cells, T-47D cells
• Positive IP detected in: T-47D cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32063-1-AP targets FBXO16 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36230

  Product name: Recombinant human FBXO16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC074986

  Sequence: MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP

• Full Name: F-box protein 16
• Calculated Molecular Weight: 292 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC074986
• Gene Symbol: FBXO16
• Gene ID (NCBI): 157574
• RRID: AB_3742520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IX29
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO16 is a member of the F-box protein family, which functions as a substrate recognition subunit of the SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. High expression levels of FBXO16 are associated with better prognosis in cancer patients. For example, in ovarian cancer, patients with higher FBXO16 expression tend to have a more favorable outcome (PMID: 34333526). This suggests that FBXO16 could serve as a potential biomarker for cancer prognosis and therapeutic targeting.