FBXO16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FBXO16 Polyclonal antibody, PBS Only (32063-1-PBS)

• 

  WB analysis using 32063-1-AP (same clone as 32063-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32063-1-AP (FBXO16 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32063-1-PBS in a different storage buffer formulation.

• 

  IP experiment of T-47D using 32063-1-AP (same clone as 32063-1-PBS)

  IP result of anti-FBXO16 (IP:32063-1-AP, 4ug; Detection:32063-1-AP 1:1000) with T-47D cells lysate 1120 ug. This data was developed using the same antibody clone with 32063-1-PBS in a different storage buffer formulation.

FBXO16 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 32063-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

F box only protein 16, F box protein 16, FBX16

---

Product Information

32063-1-PBS targets FBXO16 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36230

  Product name: Recombinant human FBXO16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC074986

  Sequence: MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP

• Full Name: F-box protein 16
• Calculated Molecular Weight: 292 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC074986
• Gene Symbol: FBXO16
• Gene ID (NCBI): 157574
• RRID: AB_3742520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IX29
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FBXO16 is a member of the F-box protein family, which functions as a substrate recognition subunit of the SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. High expression levels of FBXO16 are associated with better prognosis in cancer patients. For example, in ovarian cancer, patients with higher FBXO16 expression tend to have a more favorable outcome (PMID: 34333526). This suggests that FBXO16 could serve as a potential biomarker for cancer prognosis and therapeutic targeting.