Use Able AI chat for product recommendations

FBXO21 Polyclonal antibody, PBS Only

FBXO21 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 17648-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

F box only protein 21, F box protein 21, F-box only protein 21, FBX21, FBXO 21

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

17648-1-PBS targets FBXO21 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11882

Product name: Recombinant human FBXO21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 187-537 aa of BC034045

Sequence: DQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGVPLEPVNFPSHFLLRWCQGAEGATLDIFDYIYIDAFGKGKQLTVKECEYLIGQHVTAALYGVVNVKKVLQRMVGNLLSLGKREGIDQSYQLLRDSLDLYLAMYPDQVQLLLLQARLYFHLGIWPEKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKKENIDE

Predict reactive species
Full Name F-box protein 21
Calculated Molecular Weight 537 aa, 63 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC034045
Gene Symbol FBXO21
Gene ID (NCBI) 23014
RRIDAB_3741926
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94952
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FBXO21 (F-box protein 21) is a member of the F-box protein family and serves as the substrate recognition component of the SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. In AML cells, FBXO21 can ubiquitinate p85α, a regulatory subunit of the PI3K pathway, leading to its degradation. This reduces PI3K signaling, promotes p85α dimerization, and activates ERK, thereby influencing cell proliferation and survival. Silencing FBXO21 in AML cells induces differentiation, inhibits tumor progression, and increases sensitivity to chemotherapeutic agents. FBXO21 can regulate immune responses by ubiquitinating and degrading proteins like ASK1 through pro-inflammatory cytokine pathways. It can also ubiquitinate p85α, affecting CXCL10 expression and modulating immune cell infiltration and anti-tumor activity. In renal cell carcinoma, overexpression of FBXO21 significantly suppresses ccRCC cell proliferation and metastasis both in vitro and in vivo. It may be related to the stromal score and the infiltration levels of immune cells associated with prognosis. Additionally, FBXO21 overexpression increases the expression of key molecules in the CREB pathway.

Loading...
||
New chat

Able

正在加载,请稍候...