FBXO7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87451-1-RR (same clone as 87451-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87451-1-RR (FBXO7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87451-1-PBS in a different storage buffer formulation.

FBXO7 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87451-1-PBS

Clone No.252859B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

F-box only protein 7, FBX, FBX07, FBX7, FBXO 7

---

Product Information

87451-1-PBS targets FBXO7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1035

  Product name: Recombinant human FBXO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-522 aa of BC008361

  Sequence: KALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

• Full Name: F-box protein 7
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC008361
• Gene Symbol: FBXO7
• Gene ID (NCBI): 25793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3I1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FBXO7, also named as FBX7, is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO7 recognizes BIRC2 and DLGAP5. It function in phosphorylation-dependent ubiquitination. The observed molecular weight is consistent with the findings reported in PMID: 26310625 and PMID: 33774278.