FBXO7 Recombinant monoclonal antibody

• 

  WB analysis using 87451-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87451-1-RR (FBXO7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

FBXO7 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87451-1-RR

Clone No.252859B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

F-box only protein 7, FBX, FBX07, FBX7, FBXO 7

---

Tested Applications

• Positive WB detected in: HCT 116 cells, SH-SY5Y cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87451-1-RR targets FBXO7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1035

  Product name: Recombinant human FBXO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-522 aa of BC008361

  Sequence: KALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

• Full Name: F-box protein 7
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC008361
• Gene Symbol: FBXO7
• Gene ID (NCBI): 25793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3I1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO7, also named as FBX7, is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO7 recognizes BIRC2 and DLGAP5. It function in phosphorylation-dependent ubiquitination. The observed molecular weight is consistent with the findings reported in PMID: 26310625 and PMID: 33774278.