FBXW11 Monoclonal antibody

FBXW11 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 68090-1-Ig
Clone No.1F5A10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, ELISA

BTRC2, BTRCP2, Fbw11, FBW1B, FBXW11, FBXW1B, Homologous to Slimb protein, Hos, KIAA0696

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman colon cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68090-1-Ig targets FBXW11 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3761

Product name: Recombinant human FBXW11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 216-529 aa of BC026213

Sequence: NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR

Predict reactive species
Full Name F-box and WD repeat domain containing 11
Calculated Molecular Weight 542 aa, 61 kDa
Observed Molecular Weight58-62 kDa
GenBank Accession NumberBC026213
Gene Symbol FBXW11
Gene ID (NCBI) 23291
RRIDAB_2918827
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UKB1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXW11 (also known as HOS or β-TrCP2) is a member of F-box family proteins and plays critical role in regulating the ubiquitination of phosphorylated substrates. Abnormal expression of several FBXW11 is involved in the modulation of various biological events, such as cell cycle, differentiation, migration, inflammation, and apoptosis, through targeting multiple different substrates. For instance, FBXW11 could bind to the phosphorylated IκB and β-catenin, promoting their degradation via the ubiquitin-proteasome system. In addition, FBXW11 expression is markedly increased in mouse skin tumors and promotes tumor growth by activating the NF-κB signaling (PMID: 33640602). FBXW11 has 3 isoforms with the molecular mass of 58-62 kDa.

Protocols

Product Specific Protocols
WB protocol for FBXW11 antibody 68090-1-IgDownload protocol
IHC protocol for FBXW11 antibody 68090-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...