FBXW11 Monoclonal antibody, PBS Only

FBXW11 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 68090-1-PBS
Clone No.1F5A10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, Indirect ELISA

BTRC2, BTRCP2, Fbw11, FBW1B, FBXW11, FBXW1B, Homologous to Slimb protein, Hos, KIAA0696

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68090-1-PBS targets FBXW11 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3761

Product name: Recombinant human FBXW11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 216-529 aa of BC026213

Sequence: NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR

Predict reactive species
Full Name F-box and WD repeat domain containing 11
Calculated Molecular Weight 542 aa, 61 kDa
Observed Molecular Weight58-62 kDa
GenBank Accession NumberBC026213
Gene Symbol FBXW11
Gene ID (NCBI) 23291
RRIDAB_2918827
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UKB1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FBXW11 (also known as HOS or β-TrCP2) is a member of F-box family proteins and plays critical role in regulating the ubiquitination of phosphorylated substrates. Abnormal expression of several FBXW11 is involved in the modulation of various biological events, such as cell cycle, differentiation, migration, inflammation, and apoptosis, through targeting multiple different substrates. For instance, FBXW11 could bind to the phosphorylated IκB and β-catenin, promoting their degradation via the ubiquitin-proteasome system. In addition, FBXW11 expression is markedly increased in mouse skin tumors and promotes tumor growth by activating the NF-κB signaling (PMID: 33640602). FBXW11 has 3 isoforms with the molecular mass of 58-62 kDa.

Loading...
||
New chat Able
正在加载,请稍候...