mFC tag Monoclonal antibody

• 

  WB analysis using 67122-1-Ig

  67122-1-Ig was lysised and subjected to SDS-PAGE followed by western blot with 67122-1-Ig and isotype control antibody 66360-1-Ig at dilution of 1:5000 incubated at room temperature for 1.5 hours. HRP-goat anti-mouse kappa chain secondary antibody was used for detection. .

• 

  WB analysis using 67122-1-Ig

  0.25 μL mouse serum was subjected to SDS-PAGE followed by western blot with 67122-1-Ig and isotype control antibody 66360-1-Ig at dilution of 1:10000 incubated at room temperature for 1.5 hours. HRP-goat anti-mouse kappa chain secondary antibody was used for detection. .

mFC tag Monoclonal Antibody for WB, ELISA

Cat No. 67122-1-Ig

Clone No.2F5A2

Host / Isotype

Mouse / IgG1

Reactivity

mouse

Applications

WB, ELISA

Synonyms

FC tag

---

Tested Applications

• Positive WB detected in: Mouse IgG

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67122-1-Ig targets mFC tag in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27844

  Product name: Recombinant mouse FC tag protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-232 aa of

  Sequence: PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

• Full Name: mFC tag
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 25-30 kDa
• RRID: AB_2918482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody detects the mouse Fc tag. It's mouse Fc gamma 2a.